Protein coding transcript 225553

• Transcript: Ll_transcript_172424
• CDS coordinates: 147-551 (+)
• Peptide sequence: MIDTCHLSCLHRITMVICRFRSLLSLSKTNPFFLSSSSFSIRTFSSSHLPQHLQNVGFIGLGNMGSRMAINLVKAGYKLTVYDINSDVLKKFSQMGVSTKKTPYEVSEASDVIITMLPSSAHVSMVIPMSFPFV*
• ORF Type: complete

Annotations of Ll_transcript_172424

• Blastp: Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial from Arabidopsis with 58.72% of identity
• Blastx: Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial from Arabidopsis with 60.71% of identity
• Eggnog: Dehydrogenase(COG2084)
• Kegg: Link to kegg annotations (AT4G20930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425632.1)
• Pfam: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;