Protein coding transcript 225556

• Transcript: Ll_transcript_172428
• CDS coordinates: 1286-1606 (+)
• Peptide sequence: MVGGSEEAFLAAKSVFFSMGKSAIYCGGAGSGSAAKICNNLAMAVSMLGVSEALALGQSLGVSATTLTKIFNCSSARCWSRYADLYSLNSEMTICGSKFSYNKPWN*
• ORF Type: complete

Annotations of Ll_transcript_172428

• Blastp: Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial from Arabidopsis with 70.11% of identity
• Blastx: Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial from Arabidopsis with 66.46% of identity
• Eggnog: Dehydrogenase(COG2084)
• Kegg: Link to kegg annotations (AT4G20930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425632.1)
• Pfam: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase (PF14833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;