Protein coding transcript 225558

• Transcript: Ll_transcript_172441
• CDS coordinates: 123-845 (+)
• Peptide sequence: MEGVSYARMPRVKIRELKDDYAKFELRDTDASIANALRRVMIAEVPTIAIDLVEIETNSSVLNDEFLAHRLGLIPLTSERAMSMRFSRDCDACDGDGQCEFCSVEFHLRVKCMTDQTLDVTSKDLISSDHTVTPVDFNDSSLIQSSDVNTNRGIIIVKLRRGQELKLRAIARKGIGKDHAKWSPAATVTFMYEPEIHINEDLMESLTLEEKKEWVESSPTHVFDIDVVTQQVEFFLICFL*
• ORF Type: complete

Annotations of Ll_transcript_172441

• Blastp: DNA-directed RNA polymerases II, IV and V subunit 3 from Arabidopsis with 78.97% of identity
• Blastx: DNA-directed RNA polymerases II, IV and V subunit 3 from Arabidopsis with 78.97% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0202)
• Kegg: Link to kegg annotations (AT2G15430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422056.1)
• Pfam: RNA polymerase Rpb3/Rpb11 dimerisation domain (PF01193.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;