Transcript | Ll_transcript_172443 |
---|---|
CDS coordinates | 123-830 (+) |
Peptide sequence | MEGVSYARMPRVKIRELKDDYAKFELRDTDASIANALRRVMIAEVPTIAIDLVEIETNSSVLNDEFLAHRLGLIPLTSERAMSMRFSRDCDACDGDGQCEFCSVEFHLRVKCMTDQTLDVTSKDLISSDHTVTPVDFNDSSLIQSSDVNTNRGIIIVKLRRGQELKLRAIARKGIGKDHAKWSPAATVTFMYEPEIHINEDLMESLTLEEKKEWVESSPTRVFDIDPVTQEVGFF* |
ORF Type | complete |
Blastp | DNA-directed RNA polymerases II, IV and V subunit 3 from Arabidopsis with 78.97% of identity |
---|---|
Blastx | DNA-directed RNA polymerases II, IV and V subunit 3 from Arabidopsis with 78.97% of identity |
Eggnog | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0202) |
Kegg | Link to kegg annotations (AT2G15430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445856.1) |
Pfam | RNA polymerase Rpb3/Rpb11 dimerisation domain (PF01193.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer