Protein coding transcript 225612

• Transcript: Ll_transcript_173218
• CDS coordinates: 591-1112 (-)
• Peptide sequence: MRLRYTGRGKKNSSKSFRVGVKKGSDGLRRIFGRSLKSGVAWSVFPEDLKVSERKVFDPQDKNLLYWNKFLQILCILSISCDPLFFYLPYFNHKSFCLAIDNKLASFSVTLRTIFDCIYLIRISFQFRTAFIAPSSRVFGRGELVIDPSQIAKRYLQRYFIVDFISVLPMPQV*
• ORF Type: complete

Annotations of Ll_transcript_173218

• Blastp: Putative cyclic nucleotide-gated ion channel 8 from Arabidopsis with 65.48% of identity
• Blastx: Probable cyclic nucleotide-gated ion channel 6 from Arabidopsis with 60.48% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: Link to kegg annotations (AT1G19780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016195901.1)
• Pfam: Ion transport protein (PF00520.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;