Transcript | Ll_transcript_172984 |
---|---|
CDS coordinates | 1009-1911 (+) |
Peptide sequence | MLERDVLETSPGIRWDDVAGLTEAKRLLEEAVVLPLWMPEYFQGIRRPWKGVLMFGPPGTGKTLLAKAVATECGTTFFNVSSATLASKWRGESERMVRCLFDLARAYAPSTIFIDEIDSLCNARGASGEHESSRRVKSELLVQVDGVNNTSTNEDGSRKIVMVLAATNFPWDIDEALRRRLEKRIYIPLPNFESRKELIRINLKTVEVATDVNIDDVARRTEGYSGDDLTNVCRDASLNGMRRKIAGKTRDEIKNMPKDEISKDPVEMCDFEEALKKVQRSVSPADIDRHEKWFHEFGSA* |
ORF Type | complete |
Blastp | Katanin p60 ATPase-containing subunit A1 from Arabidopsis with 90.33% of identity |
---|---|
Blastx | Katanin p60 ATPase-containing subunit A1 from Arabidopsis with 88.27% of identity |
Eggnog | katanin p60(ENOG410XPN7) |
Kegg | Link to kegg annotations (AT1G80350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448125.1) |
Pfam | Holliday junction DNA helicase ruvB N-terminus (PF05496.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer