Protein coding transcript 225632

• Transcript: Ll_transcript_172974
• CDS coordinates: 1-594 (+)
• Peptide sequence: RVNSGTRGSNAVKKGNASGKSSKTDSANGDGDDGKSKRAQYEGPDPDLAEMLERDVLETSPGVRWDDVAGLTEAKRLLEEAVVLPLWMPEYFQGIRRPWKGVLMFGPPGTGKTLLAKAVATECGTTFFNVSSATLASKWRGESERMVRCLFDLARAYAPSTIFIDEIDSLCNARGASGEHESSRRVKSELLVQVDGVN
• ORF Type: internal

Annotations of Ll_transcript_172974

• Blastp: Katanin p60 ATPase-containing subunit A1 from Arabidopsis with 87.69% of identity
• Blastx: Katanin p60 ATPase-containing subunit A1 from Arabidopsis with 87.69% of identity
• Eggnog: katanin p60(ENOG410XPN7)
• Kegg: Link to kegg annotations (AT1G80350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448125.1)
• Pfam: Holliday junction DNA helicase ruvB N-terminus (PF05496.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;