Transcript | Ll_transcript_172979 |
---|---|
CDS coordinates | 186-953 (+) |
Peptide sequence | MSGALAGLQDHLKLAREYALEGLYDTSIIFFDGAIAQINKHMSNVDDPLIRTKWMNVKKALSEETEVVKQLDAERRAFKETPAAKSRRSPSPTIPVSSAKSNFVFQPLDEYPTSSSSSSSGRGGGFANPMHDPDVWRPPSPPSRDASRRPQAARNVKKDGLWARGATTRTTTTTSVATNANARGGGARAGRANSGTRGSTAAKKGSASGKSTKTDSVNGDGDDGKSKRVQYEGPDPDLAEMLERDVLETSPGIRW* |
ORF Type | complete |
Blastp | Katanin p60 ATPase-containing subunit A1 from Arabidopsis with 63.6% of identity |
---|---|
Blastx | Katanin p60 ATPase-containing subunit A1 from Arabidopsis with 80.34% of identity |
Eggnog | katanin p60(ENOG410XPN7) |
Kegg | Link to kegg annotations (AT1G80350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458430.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer