Protein coding transcript 225700

• Transcript: Ll_transcript_170814
• CDS coordinates: 132-1205 (+)
• Peptide sequence: MGDVSDATTKKKKKGRPSLLDLQKRSLKKQQIHSLNSHSTLHHQNDDDDERTQKKQKLLIRLNSHHSFNSNIQRQTDGKVLKVTESKDGSQGESGPTTPLPDKKLLLFILDRLQKKDTHDVFSEPVDPEELPDYHDIIKNPMDFGTVRNKLEGGLYANLESFESDVFLICSNAMQYNSPDTIYHRQARAMQEIAKKDFENLRQESDSDSEPQPKPQHKIVQRGRPPGKNNIIKSLTMSPSDCVGPESSSDATLASGRDIASGSNVYNLRKALSKFQPSDLSGRASHGNLNSGAYTSWSYDWENEFPASVLKAVLRYGKKQSVVDDTRRDTYNHPVALRNEPPLVATVEDELKQLLAV*
• ORF Type: complete

Annotations of Ll_transcript_170814

• Blastp: Bromodomain and PHD finger-containing protein 3 from Homo with 43.93% of identity
• Blastx: Bromodomain and PHD finger-containing protein 3 from Homo with 45.36% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (27154)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438109.1)
• Pfam: Bromodomain (PF00439.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;