Protein coding transcript 225701

• Transcript: Ll_transcript_170815
• CDS coordinates: 123-1145 (+)
• Peptide sequence: MGDASDTTRMMKKKKKGRPSLLDLHKRSLKQKQNLDNNNLLNSHSNHCGQKNQNLFIAPNSHNPDLNLNALNNYHQTDGKGPKVTDSKHDSQGESGPTTPLPDKKLLLFILDRLQKKDTHGVFSEPVDPEELPDYHDIIKHPMDFGTVRNKLDGELYAYLEQFENDLFLICSNAMQYNSPDTIYHRQARAMQEIAKKDFENLRQDSDSDSEPQPKPQDKIVQRGRPPGKNISKSLPMSPSNRVAPESSSDATLASGGDIASGSNGYNLRKALSRFQPADSSARASHDNLNSGGYTSWSYDWENEFPGQYLYLYLPNVFLHFLLVSTIGEQIQSLLKWFLY*
• ORF Type: complete

Annotations of Ll_transcript_170815

• Blastp: Bromodomain and PHD finger-containing protein 3 from Homo with 42.99% of identity
• Blastx: Bromodomain and PHD finger-containing protein 3 from Homo with 44.33% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (27154)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006577932.1)
• Pfam: Bromodomain (PF00439.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;