Protein coding transcript 225707

• Transcript: Ll_transcript_172067
• CDS coordinates: 124-807 (+)
• Peptide sequence: MSCFNCCEEDEYNKAAESGGPYVVKNAAGNDGNYHASETAKQGAQTVKVQPIEVPSIPADELKEVTDNFGQDSLIGEGSYGRVYYGILKSEQAAAIKKLDSSKQPDQEFLAQVSMVSRLKHDNFVQLLGYCIDGNSRILAYEFASNGSLHDILHGRKGVKGAQPGPVLTWAQRVKIAVGAARGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_172067

• Blastp: Pto-interacting protein 1 from Lycopersicon with 75.44% of identity
• Blastx: Pto-interacting protein 1 from Lycopersicon with 75.44% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (544006)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428630.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;