Protein coding transcript 225708

• Transcript: Ll_transcript_172068
• CDS coordinates: 306-1007 (+)
• Peptide sequence: MSCFSCCEDDEYHKAAESGGPYIVKNAPVINSGVGNDGNYHASESAKQGAQTVKVQPIEVPSIPVDELKEVTDNFGQDSLIGEGSYGRVYYGILKSEQAAAIKKLDSSKQPDQEFLAQVSMVSRLKHDNFVQLLGYCIDGNSRILAYEFASNGSLHDILHGRKGVKGAQPGPVLTWAQRVKIAVGAARGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_172068

• Blastp: Pto-interacting protein 1 from Lycopersicon with 75.21% of identity
• Blastx: Pto-interacting protein 1 from Lycopersicon with 75.21% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (544006)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453213.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;