Protein coding transcript 225711

• Transcript: Ll_transcript_172071
• CDS coordinates: 306-989 (+)
• Peptide sequence: MSCFSCCEDDEYHKAAESGGPYIVKNAPGNDGNYHASESAKQGAQTVKVQPIEVPSIPVDELKEVTDNFGQDSLIGEGSYGRVYYGILKSEQAAAIKKLDSSKQPDQEFLAQVSMVSRLKHDNFVQLLGYCIDGNSRILAYEFASNGSLHDILHGRKGVKGAQPGPVLTWAQRVKIAVGAARGLEYLHEKADPHIIHRDIKSSNVLIFDDDVAKIADFDLSNQAPDMA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_172071

• Blastp: Pto-interacting protein 1 from Lycopersicon with 77.19% of identity
• Blastx: Pto-interacting protein 1 from Lycopersicon with 77.19% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (544006)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453214.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;