Protein coding transcript 225713

• Transcript: Ll_transcript_172073
• CDS coordinates: 1162-1563 (+)
• Peptide sequence: MSCFNCCEEDEYNKAAESGGPYVVKNAAGNDGNYHASETAKQGAQTVKVQPIEVPSIPADELKEVTDNFGQDSLIGEGSYGRVYYGILKSGQAAAIKKLDSSKQPDQEFLAQVSATTAAYYFFCYLVELVQTP*
• ORF Type: complete

Annotations of Ll_transcript_172073

• Blastp: Pto-interacting protein 1 from Lycopersicon with 63.25% of identity
• Blastx: Pto-interacting protein 1 from Lycopersicon with 87.27% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (544006)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428630.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;