Protein coding transcript 225726

• Transcript: Ll_transcript_172099
• CDS coordinates: 569-985 (+)
• Peptide sequence: MVSRLKNDNFVELHGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQRVRIAVGAARGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_172099

• Blastp: PTI1-like tyrosine-protein kinase 3 from Arabidopsis with 95.65% of identity
• Blastx: PTI1-like tyrosine-protein kinase 3 from Arabidopsis with 89.09% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G59350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452535.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;