Protein coding transcript 22577

• Transcript: Ll_transcript_319345
• CDS coordinates: 3-584 (+)
• Peptide sequence: TALFHAHIKSKHKTTSTTNNNNNPLPLNQPPFSAELQNNNVTNRRKLMSTFVATSVAVLGVQGTPLALAQNWGTRSFLREHFFEPGLSPEDAVARIKQTAEGLHSIRDMLETMSWRYVMFYIRLKQAYLDQDLKNALSTLPENRRKEYVKTANELVDNMAEFDRYVRSPKVYESYLYYEKTLKSIDELVAMLA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_319345

• Blastp: Photosynthetic NDH subunit of lumenal location 2, chloroplastic from Arabidopsis with 62.79% of identity
• Blastx: Photosynthetic NDH subunit of lumenal location 2, chloroplastic from Arabidopsis with 64.81% of identity
• Eggnog: enhancer protein(ENOG410YK3K)
• Kegg: Link to kegg annotations (AT1G14150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459581.1)
• Pfam: Oxygen evolving enhancer protein 3 (PsbQ) (PF05757.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;