Transcript | Ll_transcript_320572 |
---|---|
CDS coordinates | 949-1302 (+) |
Peptide sequence | MQIFSSKEEGNNGSEQQKSKGDQAKELLAKFGGAYLITSITLSLISFALCYALIDAGVDVQTLLQKVGISTSETSEKVGTFALAYAAHKAASPIRFPPTVALTTIVAGWMGKKAEKD* |
ORF Type | complete |
Blastp | Protein FAM210B from Homo with 29.91% of identity |
---|---|
Blastx | Protein FAM210B from Homo with 29.91% of identity |
Eggnog | family with sequence similarity 210, member B(ENOG411243X) |
Kegg | Link to kegg annotations (116151) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448864.1) |
Pfam | Protein of unknown function (DUF1279) (PF06916.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer