Transcript | Ll_transcript_170726 |
---|---|
CDS coordinates | 876-1382 (+) |
Peptide sequence | MVEQDFLSANQFEDETEGNNPLPAPPTLDEECESMDSTNSNDGEPAAPAPLKLDNNSQSSHPLIYPSYYPPFFPFPLPYWSGYSPAEPMKKEEMHEVLKPTPVHSKSPINVDELVGMSKLSLGETIGDSGPSTLKQKLQEEGPSRQSAFHATPATTSSSVNGSVIHAV* |
ORF Type | complete |
Blastp | Transcription factor KUA1 from Arabidopsis with 51.79% of identity |
---|---|
Blastx | Transcription factor KUA1 from Arabidopsis with 48.21% of identity |
Eggnog | Transcription factor(ENOG4111IMA) |
Kegg | Link to kegg annotations (AT5G47390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422370.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer