Protein coding transcript 225797

• Transcript: Ll_transcript_170721
• CDS coordinates: 120-548 (+)
• Peptide sequence: MFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDIVADEAAEAPMVEQDFLSANQFEDETEGNNPLPAPPTLDEECESMDSTNSNDGYSPAEPMKKEEMHEVLKPTPVHSKSPINVDELVGM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_170721

• Blastp: Transcription factor KUA1 from Arabidopsis with 48.34% of identity
• Blastx: Transcription factor KUA1 from Arabidopsis with 50.23% of identity
• Eggnog: Transcription factor(ENOG4111IMA)
• Kegg: Link to kegg annotations (AT5G47390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422370.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;