Protein coding transcript 225799

• Transcript: Ll_transcript_170961
• CDS coordinates: 1499-1900 (+)
• Peptide sequence: MKKSMSSGGAVTDAGRGRGITKAQPKKDFFLPQNGSRKKPTGYIEILHTDTLIQKVERVFSASHPDPVEMEKAKKVLKEHEQALVDAIARLGDVSDGESDGDPPFSQGQSMDQEIGRKKWQNDYVGDVRVLEGS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_170961

• Blastp: Protein EMSY-LIKE 2 from Arabidopsis with 50.98% of identity
• Blastx: Protein EMSY-LIKE 2 from Arabidopsis with 45.65% of identity
• Eggnog: Chromosome 11 open reading frame 30(ENOG410YF3T)
• Kegg: Link to kegg annotations (AT5G06780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451064.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;