Protein coding transcript 2258

• Transcript: Ll_transcript_322947
• CDS coordinates: 89-460 (+)
• Peptide sequence: MFLLSLRISLRGLGSLKSANVLLQCKLSSVFLFFFSSLISARVLGPENVVDSWIEFLCFKTGFMDETKCSLASFSRYCSLGQCCCLECLNNLRLFAAERVSTSPIDSTVLKPNCDVNLLLLCC*
• ORF Type: complete

Annotations of Ll_transcript_322947

• Blastp: Zinc finger CCCH domain-containing protein 34 from Oryza sativa with 27.12% of identity
• Blastx: Zinc finger CCCH domain-containing protein 19 from Oryza sativa with 45.31% of identity
• Eggnog: chromosome 12 open reading frame 50(ENOG41101ZI)
• Kegg: Link to kegg annotations (4337959)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464777.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;