Protein coding transcript 22580

• Transcript: Ll_transcript_320574
• CDS coordinates: 261-833 (+)
• Peptide sequence: MTVSLLLSSPSIASVLNKGTGKICNYASLHSHKSHVKEFKVRALKEKTEEIKTPSQSSSAEEVTKKYGLEAGLWKIFSSKEEGNNGSEQQKSKGDQAKELLAKFGGAYLITSITLSLISFALCYALIDAGVDVQTLLQKVGISTSETSEKVGTFALAYAAHKAASPIRFPPTVALTTIVAGWMGKKAEKD*
• ORF Type: complete

Annotations of Ll_transcript_320574

• Blastp: Protein FAM210B from Homo with 29.91% of identity
• Blastx: Protein FAM210B from Homo with 29.91% of identity
• Eggnog: family with sequence similarity 210, member B(ENOG411243X)
• Kegg: Link to kegg annotations (116151)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448864.1)
• Pfam: Protein of unknown function (DUF1279) (PF06916.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;