Transcript | Ll_transcript_170966 |
---|---|
CDS coordinates | 46-720 (+) |
Peptide sequence | MQLTSSALRNGLPSGAKTKKPKPSVQLPSTGVTSRSHVANRGGSSGAIATNGPAPSSYDLLIGKKVWTRWPDDNHFYEAVITDYNPAEGRHALVYDMNSVDETWEWVNLKEISPKDIRWEGEDLDPRIPHKGGRSGSGRGMKKSMSSGGAVTDAGRGRGITKAQPKKDFFLPQNGSRKKPTGYIEILHTDTLIQKVERVFSASHPDPVEMEKAKKVLKEHEQALV |
ORF Type | 3prime_partial |
Blastp | Protein EMSY-LIKE 3 from Arabidopsis with 57.46% of identity |
---|---|
Blastx | Protein EMSY-LIKE 3 from Arabidopsis with 57.02% of identity |
Eggnog | Chromosome 11 open reading frame 30(ENOG410YF3T) |
Kegg | Link to kegg annotations (AT5G13020) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451064.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer