Protein coding transcript 225821

• Transcript: Ll_transcript_171083
• CDS coordinates: 142-474 (+)
• Peptide sequence: MSYLRSTSDRRKSASKATRSAVHGGGKSKIVVNQRLQLNPDKDHQPESYEDLKSNHFGPWIFRELEKHLPSNMLNAPREKKVKYMSGILNEYLSPAERFRVLLDARRQGK*
• ORF Type: complete

Annotations of Ll_transcript_171083

• Blastp: Uncharacterized PKHD-type hydroxylase At1g22950 from Arabidopsis with 36.59% of identity
• Blastx: Uncharacterized PKHD-type hydroxylase At1g22950 from Arabidopsis with 36.59% of identity
• Eggnog: Procollagen-lysine 2-oxoglutarate 5-dioxygenase(ENOG410Y4QU)
• Kegg: Link to kegg annotations (AT1G22950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444257.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;