Protein coding transcript 225915

• Transcript: Ll_transcript_172901
• CDS coordinates: 134-580 (+)
• Peptide sequence: MNRKMKMRVIVLLSVLMSVSVGRCWGEQCGRQAGGSVCPGGLCCSQFGWCGSTTEYCGTGCQSQCGGSGGGGGGGDIGSIISRDNFNQILKHSNDAACPAKGFYTYDAFISAAKSFPNFASTGDTTTRKREIAAFLAQTSHETTGFFL*
• ORF Type: complete

Annotations of Ll_transcript_172901

• Blastp: Endochitinase from Phaseolus with 66.9% of identity
• Blastx: Endochitinase CH5B from Phaseolus with 68.6% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416817.1)
• Pfam: Chitin recognition protein (PF00187.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;