Protein coding transcript 225916

• Transcript: Ll_transcript_172902
• CDS coordinates: 134-1105 (+)
• Peptide sequence: MNRKMKMRVIVLLSVLMSVSVGRCWGEQCGRQAGGSVCPGGLCCSQFGWCGSTTEYCGTGCQSQCGGSGGGGGGGDIGSIISRDNFNQILKHSNDAACPAKGFYTYDAFISAAKSFPNFASTGDTTTRKREIAAFLAQTSHETTGGWPSAPDGPYSWGYCFVRERNPSGYCEQSTQFPCAPGKQYYGRGPIQISWNYNYGQCGKAIGVDLLNNPDLVATDPLISFKTAIWFWMTPQSPKPSCHDVITGLWNPSDSDRAAGRLPGYGTVTNIINGGLECGIGQDSRVQDRIGFYKRYCDLLGISYGTNLDCSSQRPFGSALDTM*
• ORF Type: complete

Annotations of Ll_transcript_172902

• Blastp: Endochitinase from Phaseolus with 74.76% of identity
• Blastx: Endochitinase A2 from Pisum with 80.27% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416817.1)
• Pfam: Chitin recognition protein (PF00187.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;