Protein coding transcript 225917

• Transcript: Ll_transcript_172903
• CDS coordinates: 134-847 (+)
• Peptide sequence: MNRKMKMRVIVLLSVLMSVSVGRCWGEQCGRQAGGSVCPGGLCCSQFGWCGSTTEYCGTGCQSQCGGSGGGGGGGDIGSIISRDNFNQILKHSNDAACPAKGFYTYDAFISAAKSFPNFASTGDTTTRKREIAAFLAQTSHETTGGWPSAPDGPYSWGYCFVRERNPSGYCEQSTQFPCAPGKQYYGRGPIQISWYVNIHNKYKYDDLNSGIIISNDLICLVGISKGTTTMDNVEKQ*
• ORF Type: complete

Annotations of Ll_transcript_172903

• Blastp: Endochitinase from Phaseolus with 64.38% of identity
• Blastx: Chitinase 1 from Oryza sativa with 67.93% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016187773.1)
• Pfam: Chitin recognition protein (PF00187.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;