Protein coding transcript 225964

• Transcript: Ll_transcript_172159
• CDS coordinates: 194-1171 (+)
• Peptide sequence: MDKVFNKLRNLDAYPKINEDFYSRRLAGGLVTVISAAFMLFLFFSELRLYLYSVTESKLLVDTSRGEKLHINFDVTFPAVRCSMLSLDSVDISGEQHFDIRHNIMKKRIDANGTVIEVKKDGLGAPKIERPLQKHGGRLGHDEEYCGSCFGAEESDHHCCNSCEEVREAYKKKGWALTNTDLIDQCKREGYVQRVKDEEGEGCNIHGSLELSKVAGNFHFANGKSFLNTGIFLIDLLGLQDNNINISHQINKLSFGDHYPGLVNPLDGVKWEQGATHGMYQYFIKVSLDEMVKLLLSNYEVMSSNPGTTSPPTGVRLKVMYIYLL*
• ORF Type: complete

Annotations of Ll_transcript_172159

• Blastp: Endoplasmic reticulum-Golgi intermediate compartment protein 3 from Silurana with 45.85% of identity
• Blastx: Endoplasmic reticulum-Golgi intermediate compartment protein 3 from Silurana with 45.85% of identity
• Eggnog: Endoplasmic reticulumgolgi intermediate compartment protein(ENOG410XP7X)
• Kegg: Link to kegg annotations (407904)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426306.1)
• Pfam: Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) (PF13850.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;