Protein coding transcript 225994

• Transcript: Ll_transcript_173143
• CDS coordinates: 175-1161 (+)
• Peptide sequence: MERENGEACKQFPSHGGKSLLTVAAIRRKHLEEEMNVNATSSSCSRRNNKRNGFQEQLLTQDYASNDVFRDFDFLPSGPKNYVPYCPENQGPTKRKKVSKNAIVSHPDCNMEVPVKKHGRGKGLMTVWRAANPDAGDLPIGYSLSGQEVRLTSNSILQKPLSDNKRSRKTVTTNGMLKNKIQNKRNKLQDKRNLAIQRRVGESNQYVSQIQLLKEKCDLALDSAISTEVVDRISMLIDDEELELRELQAGNDLLMCSDHLATSGMLGCSLCKDVLVKFPPDTVKMKKPICLQPWDSSPEIVKKLFKTQIPRVLWKDVCQLIEEGWLPF*
• ORF Type: complete

Annotations of Ll_transcript_173143

• Blastp: Homeobox-DDT domain protein RLT3 from Arabidopsis with 36.43% of identity
• Blastx: Homeobox-DDT domain protein RLT3 from Arabidopsis with 36.43% of identity
• Eggnog: NA(ENOG410YDFQ)
• Kegg: Link to kegg annotations (AT4G12750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421856.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;