Protein coding transcript 226027

• Transcript: Ll_transcript_173084
• CDS coordinates: 234-851 (+)
• Peptide sequence: MICFLCYCHKHTKEGSNKPPWLNLTHSQGSYIFELESFSDLHVCRDLVGVALSKHGEAAKVISEEQLSPAEMTLRIKLLQEDSKLQKLHKELVASGKLTESEFWSIKKKLLDRHESRKLKQRIGYKNSLIFDTKPTSDGRINQVKFQLTPEIKYQIFALKPAVHQAFLNFVPKKMSEVDFWNKYFKAEYLHSTKNTVAAAAEAAED
• ORF Type: 3prime_partial

Annotations of Ll_transcript_173084

• Blastp: Probable RNA polymerase II transcription factor B subunit 1-3 from Arabidopsis with 59.28% of identity
• Blastx: Probable RNA polymerase II transcription factor B subunit 1-3 from Arabidopsis with 58.76% of identity
• Eggnog: Transcription factor(ENOG410XRI6)
• Kegg: Link to kegg annotations (AT3G61420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441066.1)
• Pfam: Short C-terminal domain (PF09851.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;