Protein coding transcript 226109

• Transcript: Ll_transcript_172269
• CDS coordinates: 428-793 (+)
• Peptide sequence: MTNFKELSCFKIPSPLIDFRSLVTEEDDFQDGSFTSDIEKGFIHSSHKFDMDKGTMYGKDGTRVPSVVHDLDYNGVEDHLKRKAGSKEAGFEIFVNSDQDHKYSQWKSKTGVNSPLDERNH*
• ORF Type: complete

Annotations of Ll_transcript_172269

• Blastp: Probable protein S-acyltransferase 2 from Arabidopsis with 34.74% of identity
• Blastx: Probable protein S-acyltransferase 2 from Arabidopsis with 44.07% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT2G40990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454825.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;