| Transcript | Ll_transcript_171329 |
|---|---|
| CDS coordinates | 47-391 (+) |
| Peptide sequence | MFDFDFVRFEFDCVQDIANGELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDGADEIKEAAAKRDDEQQ* |
| ORF Type | complete |
| Blastp | 14-3-3-like protein from Pisum with 91.26% of identity |
|---|---|
| Blastx | 14-3-3-like protein from Pisum with 91.26% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431010.1) |
| Pfam | 14-3-3 protein (PF00244.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer