Protein coding transcript 226142

• Transcript: Ll_transcript_170740
• CDS coordinates: 202-777 (+)
• Peptide sequence: MLMAQIIGSYVGIATVGIFVLWYTQASFLGINLASDGHTIIELSQLRNWGECHSWSNFTVAPYTVGKGRMITFSNPCDYFSVGKVKAVTLSLTVLVAIEMFNSLNALSEDNSLRTLPPWRNPWLLLAMSISLGLHCVILYIPLLSDVFGVVPLSLNEWFMVILISVPVVFIDEILKFVVRSQRKMRKEKAA*
• ORF Type: complete

Annotations of Ll_transcript_170740

• Blastp: Calcium-transporting ATPase, endoplasmic reticulum-type from Lycopersicon with 71.89% of identity
• Blastx: Calcium-transporting ATPase, endoplasmic reticulum-type from Lycopersicon with 71.89% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (543554)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422322.1)
• Pfam: Cation transporting ATPase, C-terminus (PF00689.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;