Transcript | Ll_transcript_171378 |
---|---|
CDS coordinates | 72-683 (+) |
Peptide sequence | MINSLTLPSFATTTSPLLPPLHHAVNHHLFRRNLCTTKRCRIITVFSNHSHHTDGITVNSRAPPTTRRTVLVAPFLAAAASFLLSARAEEKTSPPPPPTAAAELPVSIQEEVITSRIYDATVIGEPLAIGKERGRVWEKLMNARVVYLGEAEQVPIRDDKELEIEIVKNLHKRCLENEKRLALAFEAFPSDLQQQLNQYLDNK* |
ORF Type | complete |
Blastp | Protein RETICULATA-RELATED 5, chloroplastic from Arabidopsis with 70.53% of identity |
---|---|
Blastx | Protein RETICULATA-RELATED 5, chloroplastic from Arabidopsis with 71.6% of identity |
Eggnog | Domain of unknown function (DUF3411)(ENOG410YH33) |
Kegg | Link to kegg annotations (AT2G40400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416858.1) |
Pfam | Haem-binding uptake, Tiki superfamily, ChaN (PF04187.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer