Protein coding transcript 226354

• Transcript: Ll_transcript_171387
• CDS coordinates: 72-713 (+)
• Peptide sequence: MINSLTLPSFATTTSPLLPPLHHAVNHHLFRRNLCTTKRCRIITVFSNHSHHTDGITVNSRAPPTTRRTVLVAPFLAAAASFLLSARAEEKTSPPPPPTAAAELPVSIQEEVITSRIYDATVIGEPLAIGKERGRVWEKLMNARVVYLGEAEQVPIRDDKELEIEIVKNLHKRCLENEKRLALAFEAFPSDLQQQLNQYLDNKYAFQCFQFLL*
• ORF Type: complete

Annotations of Ll_transcript_171387

• Blastp: Protein RETICULATA-RELATED 5, chloroplastic from Arabidopsis with 70.53% of identity
• Blastx: Protein RETICULATA-RELATED 5, chloroplastic from Arabidopsis with 71.6% of identity
• Eggnog: Domain of unknown function (DUF3411)(ENOG410YH33)
• Kegg: Link to kegg annotations (AT2G40400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416858.1)
• Pfam: Haem-binding uptake, Tiki superfamily, ChaN (PF04187.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;