Transcript | Ll_transcript_172181 |
---|---|
CDS coordinates | 746-1366 (+) |
Peptide sequence | MQEPNMVMMGSGGGLGGDHQHRQLKAEIATHPLYEQLLAAHVACLRVATPIDQLPLIDAQLSHSHNLLRSYFSQQTHSLSPHHRQDLDNFLEQYLIVLCSFKEQLQQHVRVHAVDAVMACRDIENTLQALTGASLGEGSGATMSDDEDDMRMDLSLDQSSGEGHDMMGFGPLLPTESERSLMERVRQELKIELKQVHSYEMCHSLF* |
ORF Type | complete |
Blastp | Homeobox protein knotted-1-like 7 from Arabidopsis with 72.06% of identity |
---|---|
Blastx | Homeobox protein HD1 from Brassica with 77.09% of identity |
Eggnog | homeobox(ENOG410XPMQ) |
Kegg | Link to kegg annotations (AT1G62990) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424063.1) |
Pfam | KNOX1 domain (PF03790.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer