Protein coding transcript 226532

• Transcript: Ll_transcript_172209
• CDS coordinates: 534-1283 (+)
• Peptide sequence: MQEPNLGMMGGGLGGDGGGDTQNRQLKAEIVTHPLYEQLLAAHVACLRVATPIDQLPLIDAQLSQSHHLLRSYLSQQTHSLSPHHRQDLDNFMAQYLIVLCTFKEQLQQHVRVHAVEAVMACRDIENTLQALTGVGLGEGSGATMSDDEDDMQMDLCLDQSSAEGHDMMGFGLPTESERSLMERVRQELKIELKQGFKSRIEDVREEILRKRRAGKLPGDTTSVLKNWWQQHAKWPYPTVSYGHLLHQP*
• ORF Type: complete

Annotations of Ll_transcript_172209

• Blastp: Homeobox protein knotted-1-like 7 from Arabidopsis with 76.4% of identity
• Blastx: Homeobox protein HD1 from Brassica with 78.92% of identity
• Eggnog: homeobox(ENOG410XPMQ)
• Kegg: Link to kegg annotations (AT1G62990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422213.1)
• Pfam: KNOX1 domain (PF03790.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;