Protein coding transcript 226540

• Transcript: Ll_transcript_172184
• CDS coordinates: 613-972 (+)
• Peptide sequence: MSDEEDEIMEVDLSLDESHHEIMGFGLPTESERSLMERVRQELKIELKQGFKSKIEDVREEILRKRRAGKLPGDTTSVLKNWWHQHAKWPYPTEDDKVKLVEETGLQLKQINNWFINQRK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_172184

• Blastp: Homeobox protein HD1 from Brassica with 77.34% of identity
• Blastx: Homeobox protein HD1 from Brassica with 76.43% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (106394496)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422213.1)
• Pfam: Homeobox KN domain (PF05920.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;