Protein coding transcript 226546

• Transcript: Ll_transcript_172204
• CDS coordinates: 186-557 (+)
• Peptide sequence: MSDDEDDMRMDLSLDQSSGEGHDMMGFGPLLPTESERSLMERVRQELKIELKQGFKSRIEDVREEILRKRRAGKLPGDTTSVLKNWWQQHAKWPYPTEDDKVKLVEETGLQLKQINNWFINQRK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_172204

• Blastp: Homeobox protein HD1 from Brassica with 85.83% of identity
• Blastx: Homeobox protein HD1 from Brassica with 85% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (106394496)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424063.1)
• Pfam: ELK domain (PF03789.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;