Protein coding transcript 22655

• Transcript: Ll_transcript_366324
• CDS coordinates: 40-723 (+)
• Peptide sequence: MEICHRDLKLENTLLDGSSAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLSRREYDGKVADVWSCGVTLYVMLVGAYPFEDPEDPKNFRKTLQRILSVHYSIPDYVRVTKECWHLLSRIFIANPEKRITIPEIKMHPWFLKNLPLEFTVEGEGGLQNDDIINDNDSAQSIEEILSIIQEGRKVGEGPNLCGQFVGGSMDLDDIDADADIDDVETSGDFVCAL*
• ORF Type: complete

Annotations of Ll_transcript_366324

• Blastp: Serine/threonine-protein kinase SAPK2 from Oryza sativa with 76.76% of identity
• Blastx: Serine/threonine-protein kinase SAPK2 from Oryza sativa with 75.93% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462064.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;