Protein coding transcript 22656

• Transcript: Ll_transcript_366325
• CDS coordinates: 507-962 (+)
• Peptide sequence: MLVGAYPFEDPEDPKNFRKTLQRILSVHYSIPDYVRVTKECWHLLSRIFIANPEKRITIPEIKMHPWFLKNLPLEFTVEGEGGLQNDDIINDNDSAQSIEEILSIIQEGRKVGEGPNLCGQFVGGSMDLDDIDADADIDDVETSGDFVCAL*
• ORF Type: complete

Annotations of Ll_transcript_366325

• Blastp: Serine/threonine-protein kinase SAPK2 from Oryza sativa with 65.79% of identity
• Blastx: Serine/threonine-protein kinase SAPK2 from Oryza sativa with 67.27% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462064.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;