Protein coding transcript 22658

• Transcript: Ll_transcript_366328
• CDS coordinates: 40-471 (+)
• Peptide sequence: MEICHRDLKLENTLLDGSSAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLSRREYDGKVADVWSCGVTLYVMLVGAYPFEDPEDPKNFRKTLQRILSVHYSIPDYVRVTKECWHLLSRIFIANPEKVKLIITCVCYIA*
• ORF Type: complete

Annotations of Ll_transcript_366328

• Blastp: Serine/threonine-protein kinase SAPK1 from Oryza sativa with 88.19% of identity
• Blastx: Serine/threonine-protein kinase SAPK2 from Oryza sativa with 72.77% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (4333017)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462064.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;