Protein coding transcript 2266

• Transcript: Ll_transcript_322978
• CDS coordinates: 265-876 (+)
• Peptide sequence: MASYHFLLLFLVVAARIYEAEAANKLSTNFYSCSCSKLLPIIKKGVKKAIGNEARIGASLLRLHFHDCFVNGCDASILLDDTRNFVGEQTAAANNNSARGFNVIKDIKANVEKECPGVVSCADILALAAQYSVVYLGGPSWEVGLGRRDSTTASRSDANNSIPAPFLSLSALIKNFANQGLSVKDLVALSGIKIIGEMSYTIS*
• ORF Type: complete

Annotations of Ll_transcript_322978

• Blastp: Peroxidase 4 from Vitis with 59.09% of identity
• Blastx: Peroxidase 4 from Vitis with 59.09% of identity
• Eggnog: peroxidase(ENOG410YETZ)
• Kegg: Link to kegg annotations (100257005)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433882.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;