Transcript | Ll_transcript_171852 |
---|---|
CDS coordinates | 1486-2145 (+) |
Peptide sequence | MPYIVALKHRHGACAALLSPTSAEPLVWPLSLKVISELNPETKALLEHALMDANREREKNILKGSAYSLPSPLHSDVVDDNISEVSETELCCICFEQICTIEVQDCGHQMCAQCTLALCCHGKPNPATACLTPPLCPFCRTAIAKLVVIKTEENYDDIDQDGFDINCSKISKSRKPHNLNEGDSSSFKGLTTVVSFGKMGGRSSGRIAAENECIDNKQQ* |
ORF Type | complete |
Blastp | Putative E3 ubiquitin-protein ligase XBAT31 from Arabidopsis with 65.33% of identity |
---|---|
Blastx | Putative E3 ubiquitin-protein ligase XBAT31 from Arabidopsis with 65.33% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (AT2G28840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448632.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer