Protein coding transcript 226695

• Transcript: Ll_transcript_172708
• CDS coordinates: 138-515 (-)
• Peptide sequence: KTHIDELDLQWSQGDDMVTSSESERDILDKLKPHKGLQVLSILNYKGTILPSWVGHPFYRNMTRLVLRGCINCWALPSLGQLPSLKSLEIRNFDGLVNIGEDFYKHYDDHSSLEASFPSLEDLRS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_172708

• Blastp: Putative disease resistance RPP13-like protein 1 from Arabidopsis with 35.88% of identity
• Blastx: Putative disease resistance RPP13-like protein 1 from Arabidopsis with 35.88% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G14470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455017.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;