Protein coding transcript 226790

• Transcript: Ll_transcript_98979
• CDS coordinates: 1423-2199 (+)
• Peptide sequence: MGDSFYEYLLKVWIQGNKTSAVKNYRDMWEKSMKGLLTLIRRTTPSSFAYICEKNGGSLSDKMDELACFAPGMLALGSSGYGPDESQKFLSLAEELAWTCYNFYQSTPSKLAGENYFFHSGQDMSVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNIFQAFEKNSRVESGYVGLKDVNTGVKDDMMQSFFLAETLKYLYLLFSPSSVIPLDQWVFNTEAHPLRIVPRNEMGHVENSNEKHKPLSRLGGRKGGRSD*
• ORF Type: complete

Annotations of Ll_transcript_98979

• Blastp: Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 from Arabidopsis with 82.81% of identity
• Blastx: Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 from Arabidopsis with 84.82% of identity
• Eggnog: Mannosidase alpha class(ENOG410XP04)
• Kegg: Link to kegg annotations (AT1G51590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456385.1)
• Pfam: Glycosyl hydrolase family 47 (PF01532.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;