Transcript | Ll_transcript_99677 |
---|---|
CDS coordinates | 213-1064 (+) |
Peptide sequence | MGRKGNWFLSVKKALSPEPKERKDQKSSKSKKKWFGKQKLQTSEAYSETDNAPSLPAPEEIILTYVENENSNDHVVEVATVLEAEEPVLAVQTTADKVQITAVDQFTGKPNDEVAAMRIQTAFRGYMARRALRALRGLDRLKSLMEGKVVKRQTINTLRSMQTFAHLQSQIHSRRLRMLEETQAMQKLLLQKHAKELEIVRLGEEWDESIQSKEQIEAKLLCKYEAARRRERALAYSYSHQKNGKNSSRSINPLFIDPTNPSWGWSWLERWTTARPWESHSPME |
ORF Type | 3prime_partial |
Blastp | Protein IQ-DOMAIN 1 from Arabidopsis with 46.34% of identity |
---|---|
Blastx | Protein IQ-DOMAIN 1 from Arabidopsis with 58.56% of identity |
Eggnog | NA(ENOG411040N) |
Kegg | Link to kegg annotations (AT3G09710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443054.1) |
Pfam | IQ calmodulin-binding motif (PF00612.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer