Protein coding transcript 226835

• Transcript: Ll_transcript_99678
• CDS coordinates: 213-971 (+)
• Peptide sequence: MGRKGNWFLSVKKALSPEPKERKDQKSSKSKKKWFGKQKLQTSEAYSETDNAPSLPAPEEIILTYVENENSNDHVVEVATVLEAEEPVLAVQTTADKVQITAVDQFTGKPNDEVAAMRIQTAFRGYMARRALRALRGLDRLKSLMEGKVVKRQTINTLRSMQTFAHLQSQIHSRRLRMLEETQAMQKLLLQKHAKELEIVRLGEEWDESIQSKEQIEAKLLCKYEAARRRERALAYSYSHQVFYFFLIDLHV*
• ORF Type: complete

Annotations of Ll_transcript_99678

• Blastp: Protein IQ-DOMAIN 1 from Arabidopsis with 57.34% of identity
• Blastx: Protein IQ-DOMAIN 1 from Arabidopsis with 57.34% of identity
• Eggnog: NA(ENOG411040N)
• Kegg: Link to kegg annotations (AT3G09710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443054.1)
• Pfam: IQ calmodulin-binding motif (PF00612.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;