Protein coding transcript 226843

• Transcript: Ll_transcript_99689
• CDS coordinates: 2-439 (+)
• Peptide sequence: IEGVLKSMLEEFGKNKNEVSEMDLDSLIKEVRKYLQQKRYVVFFDDVWDKDFWSKIELAVLDDKNRSRILITTRDMEVANFCKKSSFHIHNLQCLSPQQSKELFCKKAFQNERDGICLVGLDEISSKIVKKYEGYLWKLLPLIVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_99689

• Blastp: Disease resistance protein RPM1 from Arabidopsis with 32.89% of identity
• Blastx: Disease resistance protein RPM1 from Arabidopsis with 33.09% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G07040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413918.1)
• Pfam: NB-ARC domain (PF00931.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;