Protein coding transcript 226891

• Transcript: Ll_transcript_99284
• CDS coordinates: 2-580 (+)
• Peptide sequence: LFMDEISTGLDSSTTFQMINSLRQSIHILNGTAVISLLQPAPETYELFDDIILLSDGQIVYQGPRDNVLEFFEFIGFKCPERKGVADFLQEVTSRKDQEQYWANKDEPYSFITVKEFVDAFQSFHIGRKLGDELATPFDTSKGHPAVLTKNKYGVSKKELLKACVSREFLLMKRNSFVYIFKMWQTDVRLHLF
• ORF Type: internal

Annotations of Ll_transcript_99284

• Blastp: Pleiotropic drug resistance protein TUR2 from Spirodela with 77.84% of identity
• Blastx: Pleiotropic drug resistance protein TUR2 from Spirodela with 77.84% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002116)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437695.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;